52 KiB
Release 23.05 (“Stoat”, 2023.05/??)
Support is planned until the end of December 2023, handing over to 23.11.
Highlights
In addition to numerous new and upgraded packages, this release has the following highlights:
-
Core version changes:
-
default linux: 5.15 -> 6.1, all supported kernels available
-
systemd has been updated to v253.1, see the pull request for more info. It's recommended to use
nixos-rebuild bootandreboot, rather thannixos-rebuild switch- since in some rare cases the switch of a live system might fail. -
glibc: 2.35 -> 2.37
-
-
Cinnamon has been updated to 5.6, see the pull request for what is changed.
-
GNOME has been upgraded to version 44. Please see the release notes for details.
-
KDE Plasma has been updated to v5.27, see the release notes for what is changed.
-
Python implements PEP 668, providing better feedback to users that try to run
pip installsystem-wide. -
nixos-rebuildnow supports an extra--specialisationoption that can be used to change specialisation forswitchandtestcommands. -
libxcrypt, the library providing thecrypt(3)password hashing function, is now built without support for algorithms not flaggedstrong. This affects the availability of password hashing algorithms used for system login (login(1),passwd(1)), but also Apache2 Basic-Auth, Samba, OpenLDAP, Dovecot, and many other packages. -
boot.bootspec.enable(internal option) is now enabled by default because RFC-0125 was merged. This means you will have a bootspec document calledboot.jsongenerated for each system and specialisation in the top-level. This is useful to enable advanced boot usecases in NixOS such as SecureBoot.
New Services
-
Akkoma, an ActivityPub microblogging server. Available as services.akkoma.
-
Pixelfed, an Instagram-like ActivityPub server. Available as services.pixelfed.
-
blesh, a line editor written in pure bash. Available as programs.bash.blesh.
-
webhook, a lightweight webhook server. Available as services.webhook.
-
cups-pdf-to-pdf, a pdf-generating cups backend based on cups-pdf. Available as services.printing.cups-pdf.
-
clash-verge, A Clash GUI based on tauri. Available as programs.clash-verge.
-
Cloudlog, a web-based Amateur Radio logging application. Available as services.cloudlog.
-
Deepin Desktop Environment, an elegant, easy to use and reliable desktop environment. Available as services.xserver.desktopManager.deepin.
-
system-repart, grow and add partitions to a partition table. Available as systemd.repart and boot.initrd.systemd.repart
-
fzf, a command line fuzzyfinder. Available as programs.fzf.
-
readarr, Book Manager and Automation (Sonarr for Ebooks). Available as services.readarr.
-
gemstash, a RubyGems.org cache and private gem server. Available as services.gemstash.
-
gitea-actions-runner, a CI runner for Gitea/Forgejo Actions. Available as services.gitea-actions-runner.
-
gmediarender, a simple, headless UPnP/DLNA renderer. Available as services.gmediarender.
-
harmonia, Nix binary cache implemented in rust using libnix-store. Available as services.harmonia.
-
hyprland, a dynamic tiling Wayland compositor that doesn't sacrifice on its looks. Available as programs.hyprland.
-
minipro, an open source program for controlling the MiniPRO TL866xx series of chip programmers. Available as programs.minipro.
-
stevenblack-blocklist, A unified hosts file with base extensions for blocking unwanted websites. Available as networking.stevenblack.
-
Budgie Desktop, a familiar, modern desktop environment. Availabe as services.xserver.desktopManager.budgie.
-
imaginary, a microservice for high-level image processing that Nextcloud can use to generate previews. Available as services.imaginary.
-
opensearch, a search server alternative to Elasticsearch. Available as services.opensearch.
-
kavita, a self-hosted digital library. Available as services.kavita.
-
monica, an open source personal CRM. Available as services.monica.
-
authelia, is an open-source authentication and authorization server. Available under services.authelia.
-
goeland, an alternative to rss2email written in golang with many filters. Available as services.goeland.
-
alertmanager-irc-relay, a Prometheus Alertmanager IRC Relay. Available as services.prometheus.alertmanagerIrcRelay.
-
tts, a battle-tested deep learning toolkit for Text-to-Speech. Mutiple servers may be configured below services.tts.servers.
-
atuin, a sync server for shell history. Available as services.atuin.
-
esphome, a dashboard to configure ESP8266/ESP32 devices for use with Home Automation systems. Available as services.esphome.
-
networkd-dispatcher, a dispatcher service for systemd-networkd connection status changes. Available as services.networkd-dispatcher.
-
gonic, a Subsonic music streaming server. Available as services.gonic.
-
mmsd, a lower level daemon that transmits and recieves MMSes. Available as services.mmsd.
-
QDMR, a GUI application and command line tool for programming DMR radios programs.qdmr
-
keyd, a key remapping daemon for linux. Available as services.keyd.
-
consul-template, a template rendering, notifier, and supervisor for HashiCorp Consul and Vault data. Available as services.consul-template.
-
vault-agent, a template rendering and API auth proxy for HashiCorp Vault, similar to
consul-template. Available as services.vault-agent. -
trippy, a network diagnostic tool. Available as programs.trippy.
-
v2rayA, a Linux web GUI client of Project V which supports V2Ray, Xray, SS, SSR, Trojan and Pingtunnel. Available as services.v2raya.
-
rshim, the user-space rshim driver for the BlueField SoC. Available as services.rshim.
-
wstunnel, a proxy tunnelling arbitrary TCP or UDP traffic through a WebSocket connection. Instances may be configured via services.wstunnel.
-
ulogd, a userspace logging daemon for netfilter/iptables related logging. Available as services.ulogd.
-
PufferPanel, game server management panel designed to be easy to use. Available as services.pufferpanel.
-
jellyseerr, a web-based requests manager for Jellyfin, forked from Overseerr. Available as services.jellyseerr.
-
stargazer, a fast and easy to use Gemini server. Available as services.stargazer.
-
sniffnet, an application to monitor your network traffic. Available as programs.sniffnet.
-
photoprism, a AI-Powered Photos App for the Decentralized Web. Available as services.photoprism.
-
alice-lg, a looking-glass for BGP sessions. Available as services.alice-lg.
-
birdwatcher, a small HTTP server meant to provide an API defined by Barry O'Donovan's birds-eye to the BIRD internet routing daemon. Available as services.birdwatcher.
-
peroxide, a fork of the official ProtonMail bridge that aims to be similar to Hydroxide. Available as services.peroxide.
-
autosuspend, a python daemon that suspends a system if certain conditions are met, or not met.
-
sharing, a command-line tool to share directories and files from the CLI to iOS and Android devices without the need of an extra client app. Available as programs.sharing.
-
nimdow, a window manager written in Nim, inspired by dwm.
-
trurl, a command line tool for URL parsing and manipulation.
-
wgautomesh, a simple utility to help connect wireguard nodes together in a full mesh topology. Available as services.wgautomesh.
-
woodpecker-agents, a simple CI engine with great extensibility. Available as services.woodpecker-agents.
-
woodpecker-server, a simple CI engine with great extensibility. Available as services.woodpecker-server.
-
lldap, a lightweight authentication server that provides an opinionated, simplified LDAP interface for authentication. Available as services.lldap.
-
ReGreet, a clean and customizable greeter for greetd. Available as programs.regreet.
-
v4l2-relayd, a streaming relay for v4l2loopback using gstreamer. Available as services.v4l2-relayd.
-
hardware.ipu6 adds support for ipu6 based webcams on intel tiger lake and alder lake.
-
ivpn, a secure, private VPN with fast WireGuard connections. Available as services.ivpn.
-
openvscode-server, run VS Code on a remote machine with access through a modern web browser from any device, anywhere. Available as services.openvscode-server.
Backward Incompatibilities
-
carnixandcratesIOhas been removed due to being unmaintained, use alternatives such as naersk and crate2nix instead. -
services.asusdconfiguration now uses strings instead of structured configuration, as upstream switched to the RON configuration format. Support for structured configuration may return when RON generation is implemented in nixpkgs. -
checkInputshave been renamed tonativeCheckInputs, because they behave the same asnativeBuildInputswhendoCheckis set.checkInputsnow denote a new type of dependencies, added tobuildInputswhendoCheckis set. As a rule of thumb,nativeCheckInputsare tools on$PATHused during the tests, andcheckInputsare libraries which are linked to executables built as part of the tests. Similarly,installCheckInputsare renamed tonativeInstallCheckInputs, corresponding tonativeBuildInputs, andinstallCheckInputsare a new type of dependencies added tobuildInputswhendoInstallCheckis set. (Note that this change will not cause breakage to derivations withstrictDepsunset, which are most packages except python, rust, ocaml and go packages). -
buildDunePackagenow defaults tostrictDeps = truewhich means that any library should go intobuildInputsorcheckInputs. Any executable that is run on the building machine should go intonativeBuildInputsornativeCheckInputsrespectively. Example of executables areocaml,findlibandmenhir. PPXs are libraries which are built by dune and should therefore not go intonativeBuildInputs. -
borgbackupmodule now has an option for inhibiting system sleep while backups are running, defaulting to off (not inhibiting sleep), available asservices.borgbackup.jobs.<name>.inhibitsSleep. -
The
sshclient tool now disables the~Cescape sequence by default. This can be re-enabled by settingEnableEscapeCommandline yes -
The
sshmodule does not read/etc/ssh/ssh_known_hosts2anymore since this location is deprecated since 2001. -
The openssh module does not read
~/.ssh/authorized_keys2anymore since this location is deprecated since 2001. -
podmannow uses thenetavarknetwork stack. Users will need to delete all of their local containers, images, volumes, etc, by runningpodman system reset --forceonce before upgrading their systems. -
git-bughas been updated to at least version 0.8.0, which includes backwards incompatible changes. Thegit-bug-migrationpackage can be used to upgrade existing repositories. -
grayloghas been updated to version 5, which can not be upgraded directly from the previously packaged version 3.3. If you had installed the previously packaged version 3.3, please follow the upgrade path from 3.3 to 4.0 to 4.3 to 5.0. -
nushellhas been updated to at least version 0.77.0, which includes potential breaking changes in aliases. The old aliases are now available asold-aliasbut it is recommended you migrate to the new format. See Reworked aliases. -
keepassxandkeepassx2have been removed, due to upstream stopping development. Consider KeePassXC as a maintained alternative. -
The services.kubo.settings option is now no longer stateful. If you changed any of the options in services.kubo.settings in the past and then removed them from your NixOS configuration again, those changes are still in your Kubo configuration file but will now be reset to the default. If you're unsure, you may want to make a backup of your configuration file (probably /var/lib/ipfs/config) and compare after the update.
-
The Kubo HTTP API will no longer listen on localhost and will instead only listen on a Unix domain socket by default. Read the services.kubo.settings.Addresses.API option description for more information.
-
The EC2 image module no longer fetches instance metadata in stage-1. This results in a significantly smaller initramfs, since network drivers no longer need to be included, and faster boots, since metadata fetching can happen in parallel with startup of other services. This breaks services which rely on metadata being present by the time stage-2 is entered. Anything which reads EC2 metadata from
/etc/ec2-metadatashould now have anafterdependency onfetch-ec2-metadata.service -
minioremoved support for its legacy filesystem backend in RELEASE.2022-10-29T06-21-33Z. This means if your storage was created with the old format, minio will no longer start. Unfortunately minio doesn't provide a an automatic migration, they only provide instructions how to manually convert the node. To facilitate this migration we keep around the last version that still supports the old filesystem backend asminio_legacy_fs. Use it viaservices.minio.package = minio_legacy_fs;to export your data before switching to the new version. See the corresponding issue for more details. -
services.sourcehut.dispatchand the corresponding package (sourcehut.dispatchsrht) have been removed due to upstream deprecation. -
The attributes used by
services.snapper.configs.<name>have changed. Migrate from this:services.snapper.configs.example = { subvolume = "/example"; extraConfig = '' ALLOW_USERS="alice" ''; };to this:
services.snapper.configs.example = { SUBVOLUME = "/example"; ALLOW_USERS = [ "alice" ]; }; -
The services.snapserver.openFirewall module option default value has been changed from
truetofalse. You will need to explicitly set this option totrue, or configure your firewall. -
The services.tmate-ssh-server.openFirewall module option default value has been changed from
truetofalse. You will need to explicitly set this option totrue, or configure your firewall. -
The services.unifi-video.openFirewall module option default value has been changed from
truetofalse. You will need to explicitly set this option totrue, or configure your firewall. -
The option
i18n.inputMethod.fcitx5.enableRimeDatahas been removed. Default RIME data is now included infcitx5-rimeby default, and can be customized usingfcitx5-rime.override { rimeDataPkgs = [ pkgs.rime-data, package2, ... ]; } -
The udev hwdb.bin file is now built with systemd-hwdb rather than the deprecated "udevadm hwdb". This may impact mappings where the same key is defined in multiple matching entries. The updated behavior will select the latest definition in case of conflict. In general, this should be a positive change, as the hwdb source files are designed with this ordering in mind. As an example, the mapping of the HP Dev One keyboard scan code for "mute mic" is corrected by this update. This change may impact users who have worked-around previously incorrect mappings.
-
Kime has been updated from 2.5.6 to 3.0.2 and the
i18n.inputMethod.kime.configoption has been removed. Users should usedaemonModules,iconColor, andextraConfigoptions underi18n.inputMethod.kimeinstead. -
tuthas been updated from 1.0.34 to 2.0.0, and now uses the TOML format for the configuration file instead of INI. Additional information can be found here. -
i3status-rusthas been updated from 0.22.0 to 0.30.5, and this brings many changes to its configuration format. Additional information can be found here. -
The
wordpressderivation no longer contains any builtin plugins or themes. If you need them you have to add them back to prevent your site from breaking. You can find them inwordpressPackages.{plugins,themes}. -
llvmPackages_rocm.llvmwill not containclangorcompiler-rt.llvmPackages_rocm.clangwill not containllvm.llvmPackages_rocm.clangNoCompilerRthas been removed in favor of usingllvmPackages_rocm.clang-unwrapped. -
services.xserver.desktopManager.plasma5.excludePackageshas been moved toenvironment.plasma5.excludePackages, for consistency with other Desktop Environments -
The EC2 image module previously detected and automatically mounted ext3-formatted instance store devices and partitions in stage-1 (initramfs), storing
/tmpon the first discovered device. This behaviour, which only catered to very specific use cases and could not be disabled, has been removed. Users relying on this should provide their own implementation, and probably use ext4 and perform the mount in stage-2. -
teleporthas been upgraded from major version 10 to major version 12. Please see upstream upgrade instructions and release notes for versions 11 and 12. Note that Teleport does not officially support upgrades across more than one major version at a time. If you're running Teleport server components, it is recommended to first upgrade to an intermediate 11.x version by settingservices.teleport.package = pkgs.teleport_11. Afterwards, this option can be removed to upgrade to the default version (12). -
The EC2 image module previously detected and activated swap-formatted instance store devices and partitions in stage-1 (initramfs). This behaviour has been removed. Users relying on this should provide their own implementation.
-
fail2banhas been updated to 1.0.2, which has a few breaking changes compared to 0.11.2 (changelog for 1.0.1, changelog for 1.0.2) -
Calling
makeSetupHookwithout passing anameargument is deprecated. -
Top-level buildPlatform,hostPlatform,targetPlatform have been deprecated, use stdenv.X instead.
-
lib.systems.examples.ghcjsand consequentlypkgsCross.ghcjsnow use the target tripletjavascript-unknown-ghcjsinstead ofjs-unknown-ghcjs. This has been done to match an upstream decision to follow Cabal's platform naming more closely. Nixpkgs will also rejectjsas an architecture name. -
dokuwikihas been updated from 2023-07-31a (Igor) to 2023-04-04 (Jack Jackrum), which has completely removed the options to embed HTML and PHP for security reasons. The htmlok plugin can be used to regain this functionality. -
The old unsupported version 6.x of the ELK-stack and Elastic beats have been removed. Use OpenSearch instead.
-
The
cosmocpackage has been removed. The upstream scripts incosmoccshould be used instead. -
Qt 5.12 and 5.14 have been removed, as the corresponding branches have been EOL upstream for a long time. This affected under 10 packages in nixpkgs, largely unmaintained upstream as well, however, out-of-tree package expressions may need to be updated manually.
-
The services.wordpress.sites.<name>.plugins and services.wordpress.sites.<name>.themes options have been converted from sets to attribute sets to allow for consumers to specify explicit install paths via attribute name.
-
services.nextcloud.database.createLocallynow uses socket authentication and is no longer compatible with password authentication.- If you want the module to manage the database for you, unset
services.nextcloud.config.dbpassFile(andservices.nextcloud.config.dbhost, if it's set). - If you want to use password authentication and create the database locally, you will have to use
services.mysqlto set it up.
- If you want the module to manage the database for you, unset
-
protonmail-bridgepackage has been updated to major version 3. -
Nebula now runs as a system user and group created for each nebula network, using the
CAP_NET_ADMINambient capability on launch rather than starting as root. Ensure that any files each Nebula instance needs to access are owned by the correct user and group, by defaultnebula-${networkName}. -
The
i18n.inputMethod.fcitxoption has been replaced withi18n.inputMethod.fcitx5because fcitx 4pkgs.fcitxhas been removed. -
In
mastodonit is now necessary to specify location of file withPostgreSQLdatabase password. Inservices.mastodon.database.passwordFileparameter default value/var/lib/mastodon/secrets/db-passwordhas been changed tonull. -
The
--target-hostand--build-hostoptions ofnixos-rebuildno longer treat thelocalhostvalue specially – to build on/deploy to local machine, omit the relevant flag. -
The
nix.readOnlyStoreoption has been renamed toboot.readOnlyNixStoreto clarify that it configures the NixOS boot process, not the Nix daemon. -
Deprecated
xlibsWrappertransitional package has been removed in favour of direct use of its constitutents:xorg.libX11,freetypeand others. -
The latest available version of Nextcloud is v26 (available as
pkgs.nextcloud26) which uses PHP 8.2 as interpreter by default. The installation logic is as follows:- If
system.stateVersionis >=23.05,pkgs.nextcloud26will be installed by default. - If
system.stateVersionis >=22.11,pkgs.nextcloud25will be installed by default. - Please note that an upgrade from v24 (or older) to v26 directly is not possible. Please upgrade to
nextcloud25(or earlier) first. Nextcloud prohibits skipping major versions while upgrading. You can upgrade by declaringservices.nextcloud.package = pkgs.nextcloud25;. - It's recommended to use the latest version available (i.e. v26) and to specify that using
services.nextcloud.package.
- If
-
.NET 5.0 and .NET 3.1 were removed due to being end-of-life, use a newer, supported .NET version - https://dotnet.microsoft.com/en-us/platform/support/policy/dotnet-core
-
The iputils package, which is installed by default, no longer provides the
ninfod,rarpdandrdisctools. See upstream's release notes for more details and available replacements. -
The ppp plugin
rp-pppoe.sohas been renamed topppoe.soin ppp 2.4.9. Starting from ppp 2.5.0, there is no longer a alias for backwards compatiblity. Configurations that use this plugin must be updated accordingly fromplugin rp-pppoe.sotoplugin pppoe.so. See upstream change. -
services.xserver.videoDrivers now defaults to the
modesettingdriver over device-specific ones. Theradeon,amdgpuandnouveaudrivers are still available, but effectively unmaintained and not recommended for use. -
services.xserver.libinput.enable is now set by default, enabling the more actively maintained and consistently behaved input device driver.
-
To enable the HTTP3 (QUIC) protocol for a nginx virtual host, set the
quicattribute on it to true, e.g.services.nginx.virtualHosts.<name>.quic = true;. -
In
services.fail2ban,bantime-increment.<name>options now default tonull(exceptbantime-increment.enable) and are used to set the corresponding option injail.localonly if notnull. Also, enforce thatbantime-increment.formulaandbantime-increment.multipliersare not both specified. -
The default Asterisk package was changed to v20 from v19. Asterisk versions 16 and 19 have been dropped due to being EOL. You may need to update /var/lib/asterisk to match the template files in
${asterisk-20}/var/lib/asterisk. -
conntrack helper autodetection has been removed from kernels 6.0 and up upstream, and an assertion was added to ensure things don't silently stop working. Migrate your configuration to assign helpers explicitly or use an older LTS kernel branch as a temporary workaround.
-
The
services.pipewire.configoptions have been removed, as they have basically never worked correctly. All behavior defined by the default configuration can be overridden with drop-in files as necessary - see below for details. -
The catch-all
hardware.video.hidpi.enableoption was removed. Users on high density displays may want to:- Set
services.xserver.upscaleDefaultCursorto upscale the default X11 cursor for higher resolutions - Adjust settings under
fonts.fontconfigaccording to preference - Adjust
console.fontaccording to preference, though the kernel will generally choose a reasonably sized font
- Set
-
services.pipewire.media-sessionand thepipewire-media-sessionpackage have been removed, as they are no longer supported upstream. Users are encouraged to useservices.pipewire.wireplumberinstead. -
The
bagetpackage and module was removed due to being unmaintained. -
The
qlandkartegtandgarmindevpackages were removed due to being unmaintained and insecure. -
go-ethereumpackage has been updated to v1.11.5 and thepuppethcommand is no longer available as of v1.11.0. -
The
pnpmpackage has be updated to from version 7.29.1 to version 8.1.1 and Node.js 14 support has been discontinued (though, there are workarounds if Node.js 14 is still required) -
The
zplugpackage changes its output path from$outto$out/share/zplug. Users should update their dependency on${pkgs.zplug}/init.zshto${pkgs.zplug}/share/zplug/init.zsh. -
The
pict-rspackage was updated from an 0.3 alpha release to 0.3 stable, and related environment variables now require two underscores instead of one.
Other Notable Changes
-
vim_configurablehas been renamed tovim-fullto avoid confusion:vim-full's build-time features are configurable, but bothvimandvim-fullare customizable (in the sense of user configuration, like vimrc). -
Pantheon now defaults to Mutter 43 and GNOME settings daemon 43, all Pantheon packages are now tracking elementary OS 7 updates.
-
The module for the application firewall
opensnitchgot the ability to configure rules. Available as services.opensnitch.rules -
The module
usbmuxdnow has the ability to change the package used by the daemon. In case you're experiencing issues withusbmuxdyou can try an alternative program likeusbmuxd2. Available as services.usbmuxd.package -
A few openssh options have been moved from extraConfig to the new freeform option
settingsand renamed as follows:services.openssh.forwardX11toservices.openssh.settings.X11Forwardingservices.openssh.kbdInteractiveAuthentication->services.openssh.settings.KbdInteractiveAuthenticationservices.openssh.passwordAuthenticationtoservices.openssh.settings.PasswordAuthenticationservices.openssh.useDnstoservices.openssh.settings.UseDnsservices.openssh.permitRootLogintoservices.openssh.settings.PermitRootLoginservices.openssh.logLeveltoservices.openssh.settings.LogLevelservices.openssh.kexAlgorithmstoservices.openssh.settings.KexAlgorithmsservices.openssh.macstoservices.openssh.settings.Macsservices.openssh.cipherstoservices.openssh.settings.Ciphersservices.openssh.gatewayPortstoservices.openssh.settings.GatewayPorts
-
netboxwas updated to 3.5. NixOS'services.netbox.packagestill defaults to 3.3 ifstateVersionis earlier than 23.05. Please review upstream's breaking changes for 3.4.0 and for 3.5.0, and upgrade NetBox by changingservices.netbox.package. Database migrations will be run automatically. -
services.netboxnow support RFC42-style options, throughservices.netbox.settings. -
services.mastodongained a tootctl wrapped namedmastodon-tootctlsimilar tonextcloud-occwhich can be executed from any user and switches to the configured mastodon user with sudo and sources the environment variables. -
DocBook option documentation, which has been deprecated since 22.11, will now cause a warning when documentation is built. Out-of-tree modules should migrate to using CommonMark documentation as outlined in to silence this warning.
DocBook option documentation support will be removed in the next release and CommonMark will become the default. DocBook option documentation that has not been migrated until then will no longer render properly or cause errors.
-
NixOS now defaults to using nsncd (a non-caching reimplementation in Rust) as NSS lookup dispatcher, instead of the buggy and deprecated glibc-provided nscd. If you need to switch back, set
services.nscd.enableNsncd = false, but please open an issue in nixpkgs so your issue can be fixed. -
services.borgmaticnow allows for multiple configurations, placed in/etc/borgmatic.d/, you can define them withservices.borgmatic.configurations. -
service.openafsServerfeatures a new backup serverpkgs.fabsas a replacement for openafs's ownbuserver. See FABS to check if this is an viable replacement. It stores backups as volume dump files and thus better integrates into contemporary backup solutions. -
services.maddygot several updates:- Configuration of users and their credentials using
services.maddy.ensureCredentials. - TLS configuration is now possible via
services.maddy.tlswith two loaders present: ACME and file based.
- Configuration of users and their credentials using
-
The
dnsmasqservice now takes configuration via theservices.dnsmasq.settingsattribute set. The optionservices.dnsmasq.extraConfigwill be deprecated when NixOS 22.11 reaches end of life. -
kube3dhas now been renamed tok3dsince the 3d editor that originally took that name has been dropped from nixpkgs.kube3dwill continue to work as an alias for now. -
The
dokuwikiservice is now configured viaservices.dokuwiki.sites.<name>.settingsattribute set;extraConfighas been removed. The{aclUse,superUser,disableActions}attributes have been renamed accordingly.pluginsConfignow only accepts an attribute set of booleans. Passing plain PHP is no longer possible. Same applies toaclwhich now also only accepts structuredsettings. -
The
zshpackage changes the way to set environment variables on NixOS systems whereprograms.zsh.enableequalsfalse. It now sources/etc/set-environmentwhen reading the system-levelzshenvfile. Before, it sourced/etc/profilewhen reading the system-levelzprofilefile. -
The
wordpressservice now takes configuration via theservices.wordpress.sites.<name>.settingsattribute set,extraConfigis still available to append additional text towp-config.php. -
To reduce closure size in
nixos/modules/profiles/minimal.nixprofile disabled installation documentations and manuals. Also disabledlogrotateandudisks2services. -
To reduce closure size in
nixos/modules/installer/netboot/netboot-minimal.nixprofile disabled load linux firmwares, pre-installing the complete stdenv andnetworking.wirelessservice. -
The minimal ISO image now uses the
nixos/modules/profiles/minimal.nixprofile. -
The
ghcWithPackagesandghcWithHooglewrappers will now also symlink GHC's and all included libraries' documentation to$out/share/docfor convenience. If undesired, the old behavior can be restored by overriding the builders with{ installDocumentation = false; }. -
The new option
networking.nftables.checkRulesetcontrols whether the ruleset is checked for syntax or not during build. It istrueby default. The check might fail because it is in a sandbox environment. To circumvent this, the ruleset file can be edited using thenetworking.nftables.preCheckRulesetoption. -
mastodonnow supports connection to a remotePostgreSQLdatabase. -
nextcloudhas an option to enable SSE-C in S3. -
NixOS swap partitions with random encryption can now control the sector size, cipher, and key size used to setup the plain encryption device over the underlying block device rather than allowing them to be determined by
cryptsetup(8). One can use these features like so:{ swapDevices = [ { device = "/dev/disk/by-partlabel/swapspace"; randomEncryption = { enable = true; cipher = "aes-xts-plain64"; keySize = 512; sectorSize = 4096; }; } ]; } -
New option
security.pam.zfsto enable unlocking and mounting of encrypted ZFS home dataset at login. -
services.peertubenow requires you to specify the secret filesecrets.secretsFile. It can be generated by runningopenssl rand -hex 32. Before upgrading, read the release notes for PeerTube:And backup your data.
-
services.chronydis now started with additional systemd sandbox/hardening options for better security. -
PostgreSQL has opt-in support for JIT compilation. It can be enabled like this:
{ services.postgresql = { enable = true; enableJIT = true; }; } -
services.netdataoffers adeadlineBeforeStopSecoption which enable users who have netdata instance that takes time to initialize to not have systemd kill them for no reason. -
services.dhcpcdservice now don't solicit or accept IPv6 Router Advertisements on interfaces that use static IPv6 addresses. If network uses both IPv6 Unique local addresses (ULA) and global IPv6 address auto-configuration with SLAAC, must add the parameternetworking.dhcpcd.IPv6rs = true;. -
The module
services.headscalewas refactored to be compliant with RFC 0042. To be precise, this means that the following things have changed:- Most settings has been migrated under services.headscale.settings which is an attribute-set that will be converted into headscale's YAML config format. This means that the configuration from headscale's example configuration can be directly written as attribute-set in Nix within this option.
-
services.kubonow unmountsipfsMountDirandipnsMountDireven if it is killed unexpectedly whenautoMountis enabled. -
nixos/lib/make-disk-image.nixcan now mutate EFI variables, run user-provided EFI firmware or variable templates. This is now extensively documented in the NixOS manual. -
services.grafanalistens only on localhost by default again. This was changed to upstreams default of0.0.0.0by accident in the freeform setting conversion. -
Grafana Tempo has been updated to version 2.0. See the upstream upgrade guide for migration instructions.
-
A new
virtualisation.rosettamodule was added to allow runningx86_64binaries through Rosetta inside virtualised NixOS guests on Apple silicon. This feature works by default with the UTM virtualisation package. -
The new option
users.motdFileallows configuring a Message Of The Day that can be updated dynamically. -
The
rootpackage is now built with the"-Dgnuinstall=ON"CMake flag, making the output conform thebinlibsharelayout. In this layout,tutorialsis undershare/doc/ROOT/;cmake,font,icons,jsandmacroundershare/root;Makefile.compandMakefile.configunderetc/root. -
Enabling global redirect in
services.nginx.virtualHostsnow allows one to add exceptions with thelocationsoption. -
A new option
proxyCachePathhas been added toservices.nginx. Learn more about proxy_cache_path: https://nginx.org/en/docs/http/ngx_http_proxy_module.html#proxy_cache_path. -
A new option
recommendedBrotliSettingshas been added toservices.nginx. Learn more about compression in Brotli format here. -
Updated recommended settings in
services.nginx.recommendedGzipSettings:- Enables gzip compression for only certain proxied requests.
- Allow checking and loading of precompressed files.
- Updated gzip mime-types.
- Increased the minimum length of a response that will be gzipped.
-
Garage version is based on system.stateVersion, existing installations will keep using version 0.7. New installations will use version 0.8. In order to upgrade a Garage cluster, please follow upstream instructions and force services.garage.package or upgrade accordingly system.stateVersion.
-
Nebula now supports the
services.nebula.networks.<name>.isRelayandservices.nebula.networks.<name>.relaysconfiguration options for setting up or allowing traffic relaying. See the announcement for more details about relays. -
hiphas been separated intohip,hip-commonandhipcc. -
services.nginx.recommendedProxySettingsnow removes theConnectionheader preventing clients from closing backend connections. -
Resilio sync secret keys can now be provided using a secrets file at runtime, preventing these secrets from ending up in the Nix store.
-
The
firewallandnatmodule now has a nftables based implementation. Enablenetworking.nftablesto use it. -
The
services.fwupdmodule now allows arbitrary daemon settings to be configured in a structured manner (services.fwupd.daemonSettings). -
services.xserver.desktopManager.plasma5.phononBackendnow defaults to vlc according to upstrean recommendation -
The
zramSwapis now implemented withzram-generator, and the optionzramSwap.numDevicesfor using ZRAM devices as general purpose ephemeral block devices has been removed. -
As Singularity has renamed to Apptainer to distinguish from an un-renamed fork by Sylabs Inc., there are now two packages of Singularity/Apptainer:
apptainer: Fromgithub.com/apptainer/apptainer, which is the new repo after renaming.singularity: Fromgithub.com/sylabs/singularity, which is the fork by Sylabs Inc..
programs.singularitygot a newpackageoption to specify which package to use.singularity-tools.buildImagegot a new input argumentsingularityto specify which package to use. -
The new option
programs.singularity.enableFakeroot, if set totrue, provides--fakerootsupport forapptainerandsingularity. -
The
unifi-pollerpackage and corresponding NixOS module have been renamed tounpollerto match upstream. -
The
rtsp-simple-serverpackage and corresponding NixOS module have been renamed tomediamtxto match upstream. -
The new option
services.tailscale.useRoutingFeaturescontrols various settings for using Tailscale features like exit nodes and subnet routers. If you wish to use your machine as an exit node, you can set this setting toserver, otherwise if you wish to use an exit node you can set this setting toclient. The strict RPF warning has been removed as the RPF will be loosened automatically based on the value of this setting. -
openjdkfrom version 11 and above is not build withopenjfx(i.e.: JavaFX) support by default anymore. You can re-enable it by overriding, e.g.:openjdk11.override { enableJavaFX = true; };. -
Xastir can now access AX.25 interfaces via the
libax25package. -
nixos-versionnow accepts--configuration-revisionto display more information about the current generation revision -
The option
services.nomad.extraSettingsPluginshas been fixed to allow more than one plugin in the path. -
The option
services.prometheus.exporters.pihole.intervaldoes not exist anymore and has been removed. -
The option
services.gpsd.devicehas been replaced withservices.gpsd.devices, which supports multiple devices. -
k3scan now be configured with an EnvironmentFile for its systemd service, allowing secrets to be provided without ending up in the Nix Store. -
giteamodule options have been changed to be RFC042 conforming (i.e. some options were moved to be located underservices.gitea.settings) -
boot.initrd.luks.device.<name>has a newtryEmptyPassphraseoption, this is useful for OEM's who need to install an encrypted disk with a future settable passphrase -
Lisp gained a manual section, documenting a new and backwards incompatible interface. The previous interface will be removed in a future release.
-
The
bindmodule now allows the per-zoneallow-querysetting to be configured (previously it was hard-coded toany; it still defaults toanyto retain compatibility). -
make-disk-imagehandlescontentsarguments that are directories better, fixing a bug where it used to put them in a subdirectory of the intendedtarget.
Detailed migration information
Pipewire configuration overrides
Why this change?
The Pipewire config semantics don't really match the NixOS module semantics, so it's extremely awkward to override the default config, especially when lists are involved. Vendoring the configuration files in nixpkgs also creates unnecessary maintenance overhead.
Also, upstream added a lot of accomodations to allow doing most of the things you'd want to do with a config edit in better ways.
Migrating your configuration
Compare your settings to the defaults and where your configuration differs from them.
Then, create a drop-in JSON file in /etc/pipewire/<config file name>.d/99-custom.conf (the actual filename can be anything) and migrate your changes to it according to the following sections.
Repeat for every file you've modified, changing the directory name accordingly.
Things you can just copy over
If you are:
- setting properties via
*.properties - loading a new module to
context.modules - creating new objects with
context.objects - declaring SPA libraries with
context.spa-libs - running custom commands with
context.exec - adding new rules with
*.rules - running custom PulseAudio commands with
pulse.cmd
Simply move the definitions into the drop-in.
Note that the use of context.exec is not recommended and other methods of running your thing are likely a better option.
{
"context.properties": {
"your.property.name": "your.property.value"
},
"context.modules": [
{ "name": "libpipewire-module-my-cool-thing" }
],
"context.objects": [
{ "factory": { ... } }
],
"alsa.rules": [
{ "matches: { ... }, "actions": { ... } }
]
}
Removing a module from context.modules
Look for an option to disable it via context.properties ("module.x11.bell": "false" is likely the most common use case here).
If one is not available, proceed to Nuclear option.
Modifying a module's parameters in context.modules
For most modules (e.g. libpipewire-module-rt) it's enough to load the module again with the new arguments, e.g.:
{
"context.modules": [
{
"name": "libpipewire-module-rt",
"args": {
"rt.prio": 90
}
}
]
}
Note that module-rt specifically will generally use the highest values available by default, so setting limits on the pipewire systemd service is preferable to reloading.
If reloading the module is not an option, proceed to Nuclear option.
Nuclear option
If all else fails, you can still manually copy the contents of the default configuration file
from ${pkgs.pipewire.lib}/share/pipewire to /etc/pipewire and edit it to fully override the default.
However, this should be done only as a last resort. Please talk to the Pipewire maintainers if you ever need to do this.